Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Uncharacterized membrane protein SE_0528 (SE_0528)

This Recombinant Staphylococcus epidermidis Uncharacterized membrane protein SE_0528 (SE_0528) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SE_0528

UniProt

Q8CTF5

Expression Region

1-356

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAIIYNISVMVAGIYLFHRLQYSENKRMIFSKEYVTVLMTFVSLLLAAYPIPFQNEYL VHLTFVPLLFLGRYTNMIYTLTAAFIVSLVDVFIFGNSIIYGITLIVIAGIVSAVGPFLK QNDIISLLILNLISIIILLFLALLSPIYELVEILVLIPISFIITIASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEVSSKAEEKKQSLALLLIDIDGFKDVNDHYSHQ SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIRDYTLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTQEDRKSQRKVFKDADDMVHVAKSEGRNKVMFNPIVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PTEN (T401) Antibody
E45R09207G-4 50 µL

Phospho-PTEN (T401) Antibody

Sign In for Pricing
View Details
DDT (D-dopachrome tautomerase, DDCT) (MaxLight 750)
MBS6237878-01 0.1 mL

DDT (D-dopachrome tautomerase, DDCT) (MaxLight 750)

Sign In for Pricing
View Details
DDT (D-dopachrome tautomerase, DDCT) (MaxLight 750)
MBS6237878-02 5x 0.1 mL

DDT (D-dopachrome tautomerase, DDCT) (MaxLight 750)

Sign In for Pricing
View Details
Cecropin-A Mouse mAb, PE-Cy5 conjugated
orb2840993 100 µL

Cecropin-A Mouse mAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Human anti-HIV-1 p24 mAb (P1H)
A09F02-P1H 1 Each

Human anti-HIV-1 p24 mAb (P1H)

Sign In for Pricing
View Details
PCYOX1 Antibody
E19-8332-2 100 µg -100 µL

PCYOX1 Antibody

Sign In for Pricing
View Details