Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Uncharacterized membrane protein SA0701 (SA0701)

This Recombinant Staphylococcus aureus Uncharacterized membrane protein SA0701 (SA0701) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SA0701

UniProt

Q99VM8

Expression Region

1-356

Origin

Staphylococcus aureus (strain N315)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDM8, NT (PRDM8, PFM5, PR domain zinc finger protein 8, PR domain-containing protein 8) (MaxLight 405)
MBS6337099-01 0.1 mL

PRDM8, NT (PRDM8, PFM5, PR domain zinc finger protein 8, PR domain-containing protein 8) (MaxLight 405)

Sign In for Pricing
View Details
PRDM8, NT (PRDM8, PFM5, PR domain zinc finger protein 8, PR domain-containing protein 8) (MaxLight 405)
MBS6337099-02 5x 0.1 mL

PRDM8, NT (PRDM8, PFM5, PR domain zinc finger protein 8, PR domain-containing protein 8) (MaxLight 405)

Sign In for Pricing
View Details
Anti-Human CD317/BST2 Antibody (HM1.24), PerCP
HC341147-01 1 Each

Anti-Human CD317/BST2 Antibody (HM1.24), PerCP

Sign In for Pricing
View Details
Anti-Human CD317/BST2 Antibody (HM1.24), PerCP
HC341147-02 100 Tests

Anti-Human CD317/BST2 Antibody (HM1.24), PerCP

Sign In for Pricing
View Details
PPP1R2 (Ab-44) Antibody
MBS8586884-01 0.1 mg

PPP1R2 (Ab-44) Antibody

Sign In for Pricing
View Details
PPP1R2 (Ab-44) Antibody
MBS8586884-02 0.1 mL (AF405L)

PPP1R2 (Ab-44) Antibody

Sign In for Pricing
View Details