Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio 3-hydroxyacyl-CoA dehydratase (ptplad1)

This Recombinant Danio rerio 3-hydroxyacyl-CoA dehydratase (ptplad1) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase, HACD, EC= 4.2.1.-, Protein tyrosine phosphatase-like protein ptplad1, Protein-tyrosine phosphatase-like A domain-containing protein 1

UniProt

Q7SY06

Expression Region

1-359

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSALTPHVYWAQRHGEIYLRVEISDAQDLSIGVEENILQFRGQGHGAKGENEYEFSLEFL KPVKPEVKHKSTQRQVNITVRKQEEVWWNRLTKQEKKPLFLAPDFDRWLDESDAEMELRE KEEKINKVSFESRVRKDPFLGLKKGFLFMYNLVQFLGYSWIFVNMTVRLFILGQDSFYDT FHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPV VFFVFYLWSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPI FDETKLLSIPLPKATGLSLSFSYILQLYLVVMFLGLFINFRHLFKQRTRRFRTKKRKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Dysenteriae mdtJ Protein (aa 1-121)
VAng-Lsx06981-inquire Inquire

Recombinant Shigella Dysenteriae mdtJ Protein (aa 1-121)

Sign In for Pricing
View Details
Fen1 Mouse shRNA Lentiviral Particle (Locus ID 14156)
TL513144V 500 µL Each

Fen1 Mouse shRNA Lentiviral Particle (Locus ID 14156)

Sign In for Pricing
View Details
JAK2 (Phospho-Tyr1007/Tyr1008) Rabbit mAb
MBS9468185-01 0.05 mL

JAK2 (Phospho-Tyr1007/Tyr1008) Rabbit mAb

Sign In for Pricing
View Details
JAK2 (Phospho-Tyr1007/Tyr1008) Rabbit mAb
MBS9468185-02 0.1 mL

JAK2 (Phospho-Tyr1007/Tyr1008) Rabbit mAb

Sign In for Pricing
View Details
JAK2 (Phospho-Tyr1007/Tyr1008) Rabbit mAb
MBS9468185-03 5x 0.1 mL

JAK2 (Phospho-Tyr1007/Tyr1008) Rabbit mAb

Sign In for Pricing
View Details
YAP1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-3605R-PerCP-Cy5.5 100 µL

YAP1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details