Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio 3-hydroxyacyl-CoA dehydratase (ptplad1)

This Recombinant Danio rerio 3-hydroxyacyl-CoA dehydratase (ptplad1) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase, HACD, EC= 4.2.1.-, Protein tyrosine phosphatase-like protein ptplad1, Protein-tyrosine phosphatase-like A domain-containing protein 1

UniProt

Q7SY06

Expression Region

1-359

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSALTPHVYWAQRHGEIYLRVEISDAQDLSIGVEENILQFRGQGHGAKGENEYEFSLEFL KPVKPEVKHKSTQRQVNITVRKQEEVWWNRLTKQEKKPLFLAPDFDRWLDESDAEMELRE KEEKINKVSFESRVRKDPFLGLKKGFLFMYNLVQFLGYSWIFVNMTVRLFILGQDSFYDT FHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPV VFFVFYLWSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPI FDETKLLSIPLPKATGLSLSFSYILQLYLVVMFLGLFINFRHLFKQRTRRFRTKKRKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GATA2 Antibody Picoband® Fluoro594 Conjugated
A01415-1-Fluoro594 100 µg/Vial

Anti-GATA2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
IDH2 Mouse mAb Antibody
orb3064082-01 50 µL

IDH2 Mouse mAb Antibody

Sign In for Pricing
View Details
IDH2 Mouse mAb Antibody
orb3064082-02 100 µL

IDH2 Mouse mAb Antibody

Sign In for Pricing
View Details
Recombinant ASFV Mal-006 Protein (aa 20-116)
VAng-2133Lsx-50g 50 µg

Recombinant ASFV Mal-006 Protein (aa 20-116)

Sign In for Pricing
View Details
GPR83 Antibody
A67318-100UG 100 µg

GPR83 Antibody

Sign In for Pricing
View Details
Olfr1018 siRNA Oligos set (Mouse)
32517174 3x 5 nmol

Olfr1018 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details