Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nuphar advena NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic

This Recombinant Nuphar advena NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 1, NDH subunit 1, NADH-plastoquinone oxidoreductase subunit 1

UniProt

A1XG10

Expression Region

1-361

Origin

Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIEEAQAINSFFRSESSKEVYGLIWLLVPILTLVLGITIGVLVIVWLERKISAGIQRRI GPEYAGPLGILQALADGVKLLFKEDLLPSRGDIRLFSVGPSIAVVSILLSYSVIPFGHHL VLTDLSIGVSLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTPCVLSI SLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIVFIISSLAECERLPFDLPEAEEELVA GYQTEYSGIKFGLFYVASYLNLLVSSLFVTILYLGGWNLSIPYIPITELFEKNQTSEVFG TTISLLITLAKAYLFLFIPISTRWTLPRMRMDQLLNLGWKSLLPIALGNLLLTTSSQLVS L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-100 1x 100 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details