Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nymphaea alba NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

This Recombinant Nymphaea alba NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic (ndhA) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 1, NDH subunit 1, NADH-plastoquinone oxidoreductase subunit 1

UniProt

Q6EVZ5

Expression Region

1-361

Origin

Nymphaea alba (White water-lily) (Castalia alba)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIEEAQAINSFFRSESSKEVYGLIWLLVPILTLVLGITIGVLVIVWLERKISAGIQRRI GPEYAGPLGILQALADGVKLLFKEDLLPSRGDIRLFSVGPSVAVVSILLSYSVIPFGYHL VLTDLSIGVFLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTPCVLSI SLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFLVFIISSLAECERLPFDLPEAEEELVA GYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLPIPYIPITELFEINKTSEVFG TTISLLITLAKAYLFLFIPISTRWTLPRLRMDQLLNLGWKSLLPIALGNLLLTTSSQLVS L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-100 1x 100 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-100 1x 100 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-500 1x 500 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-100 1x 100 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (AE-1 / AE-3), CF594 conjugate, 0.1mg/mL