Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbD (pcbD)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbD (pcbD) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbD

UniProt

Q7VBC8

Expression Region

1-361

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPEVTYGWWAGNSVVTNRSGRFIASHVGHTGLICFAAGGSTLWELARYNPEIPMG HQSSLFLAHLASIGIGFDEAGAWTGVGVATIAIVHLILSMVYGGGGLLHGILFDENVEDS EVLQAKKFKLEWNNPDNQTFILGHHLIFMGVACAWFVEWARIHGIYDPALGAIRQVNYNL DLSMIWQRQFDFITIDSLEDVMGGHAFLAFAEITGGAFHIVAGSTPWEDKKLGEWSKFKG SELLSAEAVLSWSLAGIGWMAIVAAFWCASNTTVYPEAWYGEPLQFKFAISPYWVDTGDL SDATAFWGHSARAALTNVHYYLGFFFLQGHFWHALRALGFNFKNVTASIGNEQKATFTIK S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal SOX2 Antibody (SOX2/3169R) [DyLight 680]
NBP3-08508FR 100 µL

Rabbit Monoclonal SOX2 Antibody (SOX2/3169R) [DyLight 680]

Sign In for Pricing
View Details
Guinea Pig Calsequestrin 2 (CASQ2) ELISA Kit
GTR10316780 96 Well

Guinea Pig Calsequestrin 2 (CASQ2) ELISA Kit

Sign In for Pricing
View Details
TRNAG8 3'UTR Lenti-reporter-Luc Vector
48068081 1.0 µg

TRNAG8 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TNNC2 Antibody
E047442 100 µg -100 µL

TNNC2 Antibody

Sign In for Pricing
View Details
Recombinant Bordetella Parapertussis gpmA Protein (aa 1-250)
VAng-Lsx4603-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Parapertussis gpmA Protein (aa 1-250)

Sign In for Pricing
View Details
Octyl b-D-glucopyranoside
GC9098-1g 1 g

Octyl b-D-glucopyranoside

Sign In for Pricing
View Details