Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbD (pcbD)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbD (pcbD) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbD

UniProt

Q7VBC8

Expression Region

1-361

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPEVTYGWWAGNSVVTNRSGRFIASHVGHTGLICFAAGGSTLWELARYNPEIPMG HQSSLFLAHLASIGIGFDEAGAWTGVGVATIAIVHLILSMVYGGGGLLHGILFDENVEDS EVLQAKKFKLEWNNPDNQTFILGHHLIFMGVACAWFVEWARIHGIYDPALGAIRQVNYNL DLSMIWQRQFDFITIDSLEDVMGGHAFLAFAEITGGAFHIVAGSTPWEDKKLGEWSKFKG SELLSAEAVLSWSLAGIGWMAIVAAFWCASNTTVYPEAWYGEPLQFKFAISPYWVDTGDL SDATAFWGHSARAALTNVHYYLGFFFLQGHFWHALRALGFNFKNVTASIGNEQKATFTIK S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC171 siRNA (Human)
MBS8230548-01 15 nmol

CCDC171 siRNA (Human)

Sign In for Pricing
View Details
CCDC171 siRNA (Human)
MBS8230548-02 30 nmol

CCDC171 siRNA (Human)

Sign In for Pricing
View Details
CCDC171 siRNA (Human)
MBS8230548-03 5x 30 nmol

CCDC171 siRNA (Human)

Sign In for Pricing
View Details
Human LARP7 (La-related protein 7) Quick ELISA Kit
orb2568239-01 48 Tests

Human LARP7 (La-related protein 7) Quick ELISA Kit

Sign In for Pricing
View Details
Human LARP7 (La-related protein 7) Quick ELISA Kit
orb2568239-02 96 Tests

Human LARP7 (La-related protein 7) Quick ELISA Kit

Sign In for Pricing
View Details
Properdin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-8306R-BF350-TR 20 µL

Properdin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details