Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbD (pcbD)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbD (pcbD) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbD

UniProt

Q7VBC8

Expression Region

1-361

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPEVTYGWWAGNSVVTNRSGRFIASHVGHTGLICFAAGGSTLWELARYNPEIPMG HQSSLFLAHLASIGIGFDEAGAWTGVGVATIAIVHLILSMVYGGGGLLHGILFDENVEDS EVLQAKKFKLEWNNPDNQTFILGHHLIFMGVACAWFVEWARIHGIYDPALGAIRQVNYNL DLSMIWQRQFDFITIDSLEDVMGGHAFLAFAEITGGAFHIVAGSTPWEDKKLGEWSKFKG SELLSAEAVLSWSLAGIGWMAIVAAFWCASNTTVYPEAWYGEPLQFKFAISPYWVDTGDL SDATAFWGHSARAALTNVHYYLGFFFLQGHFWHALRALGFNFKNVTASIGNEQKATFTIK S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATR Protein Vector (Mouse) (pPB-C-His)
PV157566 500 ng

ATR Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Research Grade Tanezumab
MBS1563316-01 0.1 mg

Research Grade Tanezumab

Sign In for Pricing
View Details
Research Grade Tanezumab
MBS1563316-02 1 mg

Research Grade Tanezumab

Sign In for Pricing
View Details
Research Grade Tanezumab
MBS1563316-03 5x 1 mg

Research Grade Tanezumab

Sign In for Pricing
View Details
Human ACSF2 Protein
orb423955-01 5 µg

Human ACSF2 Protein

Sign In for Pricing
View Details
Human ACSF2 Protein
orb423955-02 20 µg

Human ACSF2 Protein

Sign In for Pricing
View Details