Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbE (pcbE)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbE (pcbE) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbE

UniProt

Q9L8M2

Expression Region

1-361

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDPTYGWWVGNSVVTNKSSRFIGSHVAHTGLIAFTAGANTLWELARFNPDIPMG HQGMVSIPHLASLGIGFDQAGAWTGQDVAFVGIFHLICSFVYALAGLLHSVIFSEDTQNS SGLFADGRPEHRQAARFKLEWDNPDNQTFILGHHLVFFGVANIWFVEWARVHGIYDPAIE AIRQVNYNLDLTQIWNHQFDFIQIDSLEDVMGGHAFLAFFQIGGGAFHIATKQIGTYTNF KGAGLLSAEAVLSWSLAGIGWMAIIAAFWCATNTTVYPEAWYGETLQLKFGISPYWIDTG NMDGVVTGHTSRAWLSNVHYYLGFFFIQGHLWHAIRAMGFDFRKVTSAVANLDNSRITLS D

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A5 (NM_173596) Human Tagged ORF Clone
RC206665 10 µg

SLC39A5 (NM_173596) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rat A-kinase anchor protein 5 (AKAP5) ELISA Kit
MBS7216645-01 48 Well

Rat A-kinase anchor protein 5 (AKAP5) ELISA Kit

Sign In for Pricing
View Details
Rat A-kinase anchor protein 5 (AKAP5) ELISA Kit
MBS7216645-02 96 Well

Rat A-kinase anchor protein 5 (AKAP5) ELISA Kit

Sign In for Pricing
View Details
Rat A-kinase anchor protein 5 (AKAP5) ELISA Kit
MBS7216645-03 5x 96 Well

Rat A-kinase anchor protein 5 (AKAP5) ELISA Kit

Sign In for Pricing
View Details
Rat A-kinase anchor protein 5 (AKAP5) ELISA Kit
MBS7216645-04 10x 96 Well

Rat A-kinase anchor protein 5 (AKAP5) ELISA Kit

Sign In for Pricing
View Details
RFP sdAb monoclonal camelid FluoTag-Q
N0401-AF568-L 200 µL

RFP sdAb monoclonal camelid FluoTag-Q

Sign In for Pricing
View Details