Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbF

UniProt

Q46JW5

Expression Region

1-362

Origin

Prochlorococcus marinus (strain NATL2A)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSYGNPDVTYGWWVGNSVVTNKSSRFIGSHVAHTGLICFAAGANTLWELARYNPDIPMG HQGMVSIPHLASIGIGFDPTGTVFDGTSIAFIGVFHLICSMVYAGAGLLHSLIFSEDTQN SSGLFADDRPEHRQAARYKLEWDNPDNQTFILGHHLIFFGVACIWFVEWARIHGIYDPAI GAVRQVEYNLNLTNIWNHQFDFLAIDSLEDVMGGHAFLAFVEITGGAFHIATKQTGEYTE FKGKNILSAEAVLSWSLAGIGWMAIIAAFWCATNTTVYPEAWYGETLALKFGISPYWIDT ADMTGVVSGHTSRAWLANVHYYLGFFFIQGHLWHAIRALGFDFKKVTDAISNLDGARVTL TD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose Oxidase Rabbit Polyclonal Antibody
orb157180-01 50 μL

Glucose Oxidase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glucose Oxidase Rabbit Polyclonal Antibody
orb157180-02 100 µL

Glucose Oxidase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glucose Oxidase Rabbit Polyclonal Antibody
orb157180-03 200 µL

Glucose Oxidase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Slc12a5 shRNA (UAS) - Lentiviral mouse Slc12a5 shRNA (UAS, RFP) (100)
GTR15229920 1 Vial

Lentiviral mouse Slc12a5 shRNA (UAS) - Lentiviral mouse Slc12a5 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Human SRP14 Protein, N-His-SUMO & C-Strep
orb2830454-01 20 µg

Recombinant Human SRP14 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Recombinant Human SRP14 Protein, N-His-SUMO & C-Strep
orb2830454-02 50 µg

Recombinant Human SRP14 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details