Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbF

UniProt

Q46JW5

Expression Region

1-362

Origin

Prochlorococcus marinus (strain NATL2A)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSYGNPDVTYGWWVGNSVVTNKSSRFIGSHVAHTGLICFAAGANTLWELARYNPDIPMG HQGMVSIPHLASIGIGFDPTGTVFDGTSIAFIGVFHLICSMVYAGAGLLHSLIFSEDTQN SSGLFADDRPEHRQAARYKLEWDNPDNQTFILGHHLIFFGVACIWFVEWARIHGIYDPAI GAVRQVEYNLNLTNIWNHQFDFLAIDSLEDVMGGHAFLAFVEITGGAFHIATKQTGEYTE FKGKNILSAEAVLSWSLAGIGWMAIIAAFWCATNTTVYPEAWYGETLALKFGISPYWIDT ADMTGVVSGHTSRAWLANVHYYLGFFFIQGHLWHAIRALGFDFKKVTDAISNLDGARVTL TD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ribonuclease K6 Recombinant Protein C-6 His Tag
MBS8433283-01 0.05 mg

Human Ribonuclease K6 Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
Human Ribonuclease K6 Recombinant Protein C-6 His Tag
MBS8433283-02 5x 0.05 mg

Human Ribonuclease K6 Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
NT2NL Rabbit pAb, PE-Cy5 conjugated
orb2889412 100 µL

NT2NL Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
PCDHGC5 (Protocadherin gamma-C5, PCDH-gamma-C5, MGC138286, MGC138288, PCDH-GAMMA-C5) (MaxLight 550)
130984-ML550 100 µL

PCDHGC5 (Protocadherin gamma-C5, PCDH-gamma-C5, MGC138286, MGC138288, PCDH-GAMMA-C5) (MaxLight 550)

Sign In for Pricing
View Details
SMARCA4 Antibody, mAb, Rabbit
A03177-50 50 µL

SMARCA4 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
PRDX2 Antibody
MBS7046127-01 0.05 mg

PRDX2 Antibody

Sign In for Pricing
View Details