Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 3 (ptplad1)

This Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 3 (ptplad1) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 3, HACD3, EC= 4.2.1.-, Butyrate-induced protein 1, B-ind1, Protein tyrosine phosphatase-like protein PTPLAD1, Protein-tyrosine phos

UniProt

Q8K2C9

Expression Region

1-362

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METQVLTPHVYWAQRHRELYLRVELSDVQNPAISITDNVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPAYRLTQRQVNITVQKKGSHWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEERLNKLRLEREGSPETLTNLKKGYLFMYNLVQLLGFSWIFVNLTVRFFILGKESF YDTFHNVADMMYFCQMLALVETLNAAIGVTSTPVLPALIQFLGRNFILFLVFGTMEEMQN KAVVFFVFYSWSAIEIFRYPFYMLSCIDMDWKVLTWLRYTMWIPLYPLGCLSEAVAVIQS IPVFNESGRFSFTLPYPVKMKVRFSFFLQVYLVMLFLGLYINFRHLYKQRRRRYGQKKKK LH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTRA1 Mouse Monoclonal Antibody [Clone ID: OTI2F12]
CF816106 100 µg

HTRA1 Mouse Monoclonal Antibody [Clone ID: OTI2F12]

Sign In for Pricing
View Details
EGFR (GFR1195), CF594 conjugate, 0.1mg/mL
BNC941195-500 1x 500 µL

EGFR (GFR1195), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac-Ruxolitinib-d9 (major)
TRC-R701998-25MG 25 mg

rac-Ruxolitinib-d9 (major)

Sign In for Pricing
View Details
Human C17orf59 (BORCS6) activation kit by CRISPRa
GA110260 1 Kit

Human C17orf59 (BORCS6) activation kit by CRISPRa

Sign In for Pricing
View Details
Adjustable Glass-Injection Dispenser BPIP-201
BPIP-201 1 Unit

Adjustable Glass-Injection Dispenser BPIP-201

Sign In for Pricing
View Details
Cyclin B1 (CCNB1/1098), CF594 conjugate, 0.1mg/mL
BNC941098-100 1x 100 µL

Cyclin B1 (CCNB1/1098), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details