Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1)

This Recombinant Human 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 3, HACD3, EC= 4.2.1.-, Butyrate-induced protein 1, B-ind1, hB-ind1, Protein tyrosine phosphatase-like protein PTPLAD

UniProt

Q9P035

Expression Region

1-362

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESF YDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQN KAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQS IPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK IH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM29A (HAUS6) activation kit by CRISPRa
GA110270 1 Kit

Human FAM29A (HAUS6) activation kit by CRISPRa

Sign In for Pricing
View Details
3-(1H-imidazol-4-yl)propanoic Acid
TRC-I385623-50MG 50 mg

3-(1H-imidazol-4-yl)propanoic Acid

Sign In for Pricing
View Details
CA3 Antibody (Biotin)
KB-8147-01 50 μL

CA3 Antibody (Biotin)

Sign In for Pricing
View Details
CA3 Antibody (Biotin)
KB-8147-02 100 µL

CA3 Antibody (Biotin)

Sign In for Pricing
View Details
CA3 Antibody (Biotin)
KB-8147-03 1 mL

CA3 Antibody (Biotin)

Sign In for Pricing
View Details
ZAP70 pTyr493 Rabbit Polyclonal Antibody
AP02442PU-N 100 µL

ZAP70 pTyr493 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details