Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1)

This Recombinant Human 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 3, HACD3, EC= 4.2.1.-, Butyrate-induced protein 1, B-ind1, hB-ind1, Protein tyrosine phosphatase-like protein PTPLAD

UniProt

Q9P035

Expression Region

1-362

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESF YDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQN KAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQS IPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK IH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC39B Human Gene Knockout Kit (CRISPR)
KN423149 1 Kit

TTC39B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL 6 Rat
OM296520-01 10 µg

IL 6 Rat

Sign In for Pricing
View Details
IL 6 Rat
OM296520-02 2 µg

IL 6 Rat

Sign In for Pricing
View Details
IL 6 Rat
OM296520-03 1 mg

IL 6 Rat

Sign In for Pricing
View Details
Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-,  5nm
GP-2401-5 1 mL

Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-, 5nm

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2712), CF647 conjugate, 0.1mg/mL
BNC472712-500 1x 500 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2712), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details