Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1)

This Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 3 (PTPLAD1) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 3, HACD3, EC= 4.2.1.-, Protein tyrosine phosphatase-like protein PTPLAD1, Protein-tyrosine phosphatase-like A domain-containing protein 1

UniProt

A7YY55

Expression Region

1-362

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENQVLTPHVYWAQRHHELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPVYKLTQRQVNITVQKKESQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEEQLNKLRLESQGSPETLTSLKKGYLFMYNLVQFLGFSWIFVNMTVRFFILGKESF YDTFHTVADMMYFCQMLAAVESINAAIGVTKSPVVPSLFQLLGRNFILFIIFGTMEEMQN KAVVFFVFYIWSTVEIFRYPFYMLSCIDMDWKVLTWLRYTVWIPLYPMGCLAEAVSVIQS IPVFNETGRFSFTLPYPVKIKVRFSFFLQIYLILLFLGLYVNFRYLYKQRRRRFGQKKKK IH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ION Vital - Viability Kit, live or dead assay kit for mammalian cells
5000 15 Plates

ION Vital - Viability Kit, live or dead assay kit for mammalian cells

Sign In for Pricing
View Details
Biotin Mouse IgG2b, κ Isotype Control
RD22470F-01 25 µg

Biotin Mouse IgG2b, κ Isotype Control

Sign In for Pricing
View Details
Biotin Mouse IgG2b, κ Isotype Control
RD22470F-02 100 µg

Biotin Mouse IgG2b, κ Isotype Control

Sign In for Pricing
View Details
STAT5A pTyr695/699 Mouse Monoclonal Antibody [Clone ID: 5G4]
AM00150PU-N 100 µg

STAT5A pTyr695/699 Mouse Monoclonal Antibody [Clone ID: 5G4]

Sign In for Pricing
View Details
TCPTP Recombinant Rabbit Monoclonal Antibody [JE57-07]
HA720074 100 µL

TCPTP Recombinant Rabbit Monoclonal Antibody [JE57-07]

Sign In for Pricing
View Details
tert-Butyl 4-Iodobenzoate
TRC-B692420-2G 2 g

tert-Butyl 4-Iodobenzoate

Sign In for Pricing
View Details