Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ranunculus macranthus NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic

This Recombinant Ranunculus macranthus NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 1, NDH subunit 1, NADH-plastoquinone oxidoreductase subunit 1

UniProt

A1XGT6

Expression Region

1-363

Origin

Ranunculus macranthus (Large buttercup)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIDTTKLQAINSFYRSESLKEVYGLVWLLIPIFILVLGIVIGVLVIVWLERQISAGVQQ RIGPEYAGPLGILQALADGTKLLFKEDLLPSRGDIYLFSIGPSIAVIAILLSYLVIPFGY HLVLADLSIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTPCVL SISLLSNSSSTVDIVEAQAKYGFWGWNLWRQPIGFTVFFISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPHILIPELFGINEMGGV FGMTIGIFITLAKAYLFLFISITTRWTLPRMRMDQLLNLGWKFLLPISLGNLLLTTSFQL FSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-500 1x 500 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-500 1x 500 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details