Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus globulus subsp. globulus NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

This Recombinant Eucalyptus globulus subsp. globulus NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic (ndhA) spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 1, NDH subunit 1, NADH-plastoquinone oxidoreductase subunit 1

UniProt

Q49KU3

Expression Region

1-363

Origin

Eucalyptus globulus subsp. globulus (Tasmanian blue gum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIDTTEVQDLNSFSRLESLKEVYGIIGMFLPILTLVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLIFKENLFPSRGDTRLFSIGPSIAVISILLSYSVIPFSY HLVLSDLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLSGLRAAAQSISYEIPLTLLCV INISLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFFIFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNISIPYIFVPELFEINKVGRV FGTTIGIFITLAKTYFFLFISITTRWTLPRLRIDQLLNLGWKFLLPISLGNLLLTTSFQL LSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-100 1x 100 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-500 1x 500 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (9E10.3), CF770 conjugate, 0.1mg/mL
BNC700596-500 1x 500 µL

C-Myc (9E10.3), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF647 conjugate, 0.1mg/mL
BNC472959-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details