Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitoferrin-2 (Slc25a28)

This Recombinant Mouse Mitoferrin-2 (Slc25a28) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Mitoferrin-2, Mitochondrial RNA-splicing protein 3/4 homolog, MRS3/4, Mitochondrial iron transporter 2, Solute carrier family 25 member 28

UniProt

Q8R0Z5

Expression Region

1-364

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELEGRSAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGAYQPPVRLDPESG PEYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWR IMRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVA TLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQA IHFMTYEFLQEHFNPQRRYNPSSHVLCGACAGAVAAAATTPLDVCKTLLNTQESLALNSN ITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEW RAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIPSNAP3B (Protein NipSnap Homolog 3B, NipSnap3B, SNAP1, NIPSNAP3)
N2567-99 50 µg

NIPSNAP3B (Protein NipSnap Homolog 3B, NipSnap3B, SNAP1, NIPSNAP3)

Sign In for Pricing
View Details
Human FBN1 Knockout A549 cell line
GTR15412520 1 Vial

Human FBN1 Knockout A549 cell line

Sign In for Pricing
View Details
Rat Sptbn4 Pre-designed siRNA Set A
SI213722A 1 Each

Rat Sptbn4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
RPL19 Rabbit Polyclonal Antibody (Fluoro488)
orb3079344 100 µg

RPL19 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Rat Succinic Acid ELISA Kit
MBS7255570-01 48 Well

Rat Succinic Acid ELISA Kit

Sign In for Pricing
View Details
Rat Succinic Acid ELISA Kit
MBS7255570-02 96 Well

Rat Succinic Acid ELISA Kit

Sign In for Pricing
View Details