Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus alba NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

This Recombinant Populus alba NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic (ndhA) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 1, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 1, NDH subunit 1, NADH-plastoquinone oxidoreductase subunit 1

UniProt

Q14FA3

Expression Region

1-365

Origin

Populus alba (White poplar)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIDTTTVQAINSFSRLKSLNEVYGIIWMLVPILTLVLGITIGILVIVWLEREISAGIQQ RIGPEYAGPFGVLQALADGTKLLFKENLFPSRGDTRLFSIGPSIAVISTLLSYSVIPFGY HFVLADLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFGGWNLWRQPIGFIIFFISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVAVLYLGGWNISIPYISVPEFFDFEINKVG RVFGTTMGILITLVKTYLFLFIPITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSS QLFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-100 1x 100 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-100 1x 100 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-500 1x 500 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details