Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phosphatidylcholine:ceramide cholinephosphotransferase 2 (Sgms2)

This Recombinant Mouse Phosphatidylcholine:ceramide cholinephosphotransferase 2 (Sgms2) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

Phosphatidylcholine:ceramide cholinephosphotransferase 2, EC= 2.7.8.27, Sphingomyelin synthase 2

UniProt

Q9D4B1

Expression Region

1-365

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIIETAKLEGHLESQTNDSTNTYTSPTEAVEEEGKNGKGKPKTLSNGLRKGAKKYPDYI QISMPNDSKNKFPLEWWKTGIAFVYALFNLILTTVMITVVHERVPPKELSPPLPDKFFDY FDRVKWAFSVSEINGMVLVGLWITQWLFLRYKSIVGRRFFFIMGTLYLYRCITMYVTTLP VPGMHFQCAPKLNGDSQAKIQRILRLISGGGLSITGSHILCGDFLFSGHTVVLTLTYLFI KEYSPRHFWWYHLVCWLLSAAGIICILVAHEHYTVDVIIAYYITTRLFWWYHSMANEKNL KVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCRKYSRVQKIGED NEKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AADAT (KAT2, Kynurenine/alpha-aminoadipate Aminotransferase, Mitochondrial, 2-aminoadipate Aminotransferase, 2-aminoadipate Transaminase, Alpha-aminoadipate Aminotransferase, Kynurenine Aminotransferase II, Kynurenine-oxoglutarate Aminotransferase II, Kynurenine-oxoglutarate Transaminase 2, Kynurenine-oxoglutarate Transaminase II) (MaxLight 650)
122780-ML650 100 µL

AADAT (KAT2, Kynurenine/alpha-aminoadipate Aminotransferase, Mitochondrial, 2-aminoadipate Aminotransferase, 2-aminoadipate Transaminase, Alpha-aminoadipate Aminotransferase, Kynurenine Aminotransferase II, Kynurenine-oxoglutarate Aminotransferase II, Kynurenine-oxoglutarate Transaminase 2, Kynurenine-oxoglutarate Transaminase II) (MaxLight 650)

Sign In for Pricing
View Details
FAM83A, ID (D283) (FAM83A, TSGP, Protein FAM83A, Tumor antigen BJ-TSA-9, Tumor-specific gene expressed in prostate protein) (MaxLight 550) discontinued
035490-ML550 100 µL

FAM83A, ID (D283) (FAM83A, TSGP, Protein FAM83A, Tumor antigen BJ-TSA-9, Tumor-specific gene expressed in prostate protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SAC51 Polyclonal Antibody
MBS9010915 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SAC51 Polyclonal Antibody

Sign In for Pricing
View Details
NCAPG Antibody
CSB-PA050016-01 50 µg

NCAPG Antibody

Sign In for Pricing
View Details
NCAPG Antibody
CSB-PA050016-02 100 µg

NCAPG Antibody

Sign In for Pricing
View Details
HENMT1 Rabbit pAb, Pacific Blue conjugated
orb2855650 100 µL

HENMT1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details