Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lipopolysaccharide export system permease protein lptF (lptF)

This Recombinant Lipopolysaccharide export system permease protein lptF (lptF) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Lipopolysaccharide export system permease protein lptF

UniProt

P0AF99

Expression Region

1-366

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSLLGLGVPEMA QLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILAVFTAIVAAVNVMWA GPWSSRHQDEVLAEAKANPGMAALAQGQFQQATNGSSVLFIESVDGSDFKDVFLAQIRPK GNARPSVVVADSGHLTQLRDGSQVVTLNQGTRFEGTALLRDFRITDFQDYQAIIGHQAVA LDPNDTDQMDMRTLWNTDTDRARAELNWRITLVFTVFMMALMVVPLSVVNPRQGRVLSML PAMLLYLLFFLIQTSLKSNGGKGKLDPTLWMWTVNLIYLALAIVLNLWDTVPVRRLRASF SRKGAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tide Quencher™ 3WS acid [TQ3WS acid]
2227-AAT 5 mg

Tide Quencher™ 3WS acid [TQ3WS acid]

Sign In for Pricing
View Details
Mix-n-StainTM CF®710 Antibody Labeling Kit, 1x (20-50ug) labeling
#92580 1 Kit

Mix-n-StainTM CF®710 Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
Hip1 Mouse Monoclonal Antibody [13E1]
EM1901-04 100 µL

Hip1 Mouse Monoclonal Antibody [13E1]

Sign In for Pricing
View Details
Recombinant Rat FGFR4 Protein (His Tag)
PDMR100055-01 20 µg

Recombinant Rat FGFR4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat FGFR4 Protein (His Tag)
PDMR100055-02 100 µg

Recombinant Rat FGFR4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat FGFR4 Protein (His Tag)
PDMR100055-03 500 µg

Recombinant Rat FGFR4 Protein (His Tag)

Sign In for Pricing
View Details