Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lipopolysaccharide export system permease protein lptF (lptF)

This Recombinant Lipopolysaccharide export system permease protein lptF (lptF) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Lipopolysaccharide export system permease protein lptF

UniProt

P0AF99

Expression Region

1-366

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSLLGLGVPEMA QLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILAVFTAIVAAVNVMWA GPWSSRHQDEVLAEAKANPGMAALAQGQFQQATNGSSVLFIESVDGSDFKDVFLAQIRPK GNARPSVVVADSGHLTQLRDGSQVVTLNQGTRFEGTALLRDFRITDFQDYQAIIGHQAVA LDPNDTDQMDMRTLWNTDTDRARAELNWRITLVFTVFMMALMVVPLSVVNPRQGRVLSML PAMLLYLLFFLIQTSLKSNGGKGKLDPTLWMWTVNLIYLALAIVLNLWDTVPVRRLRASF SRKGAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM5B Human Gene Knockout Kit (CRISPR)
KN214918RB 1 Kit

KDM5B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-CARBOXYTetramethylrhodamine, SINGLE IS
#90008 1x 10 mg

6-CARBOXYTetramethylrhodamine, SINGLE IS

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB523679 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
OR10H4 (NM_001004465) Human Over-expression Lysate
LY423769 100 µg

OR10H4 (NM_001004465) Human Over-expression Lysate

Sign In for Pricing
View Details
ZC4H2 (NM_001178033) Human Over-expression Lysate
LY432640 100 µg

ZC4H2 (NM_001178033) Human Over-expression Lysate

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF405S conjugate, 0.1mg/mL
BNC042478-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2478), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details