Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0976 (MJ0976)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0976 (MJ0976) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0976

UniProt

Q58386

Expression Region

1-366

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEDSNPKNDLKLKMYETFRSHIERAENSFWTYMLFYLQFLVGINGAVGILCRYLSNNLQ NFPTEIIIAFLALVNILLSLIGIIVIIERGKWFFRNMILTVNLERYILKEEHIKIIPKRY SKFDNFNKVIDTTGRIFISIFIGIYMISVIALGYLANSCKTIILFGTGFFIIVVIIYFLD LLDWIYRRIDSNEYRKVIGVVLFISFIPPLMNYFIYDIINLICSYIPESFIVAMIVILIF VIIDVYYNAKKHIENTIIMLSLERTVNDIDDIIKILKNIRLDDTKKEELKKKLRKIKKLI ENVIKLLGGTSENGTQNNNLEEAKSKITEACRKISGNNIFEAINELNEAKYIINNKINEL TQSDSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPD52L1 Conjugated Antibody
C38898 100 µL

TPD52L1 Conjugated Antibody

Sign In for Pricing
View Details
Mrps7 (NM_025305) Mouse Tagged Lenti ORF Clone
MR202991L4 10 µg

Mrps7 (NM_025305) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Galanin Receptor 4 (GALR4) Rat ELISA Kit
D5930 96 Tests

Galanin Receptor 4 (GALR4) Rat ELISA Kit

Sign In for Pricing
View Details
Bottle, Narrow Mouth, Round, HDPE, 125mL
7060125 12/Bag

Bottle, Narrow Mouth, Round, HDPE, 125mL

Sign In for Pricing
View Details
Rabbit anti-human dynein, cytoplasmic 1, light intermediate chain 2 polyclonal Antibody
MBS719184-01 0.1 mL

Rabbit anti-human dynein, cytoplasmic 1, light intermediate chain 2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human dynein, cytoplasmic 1, light intermediate chain 2 polyclonal Antibody
MBS719184-02 5x 0.1 mL

Rabbit anti-human dynein, cytoplasmic 1, light intermediate chain 2 polyclonal Antibody

Sign In for Pricing
View Details