Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane transport permease ybhR (ybhR)

This Recombinant Inner membrane transport permease ybhR (ybhR) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

Inner membrane transport permease ybhR

UniProt

P0AFQ1

Expression Region

1-368

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFHRLWTLIRKELQSLLREPQTRAILILPVLIQVILFPFAATLEVTNATIAIYDEDNGEH SVELTQRFARASAFTHVLLLKSPQEIRPTIDTQKALLLVRFPADFSRKLDTFQTAPLQLI LDGRNSNSAQIAANYLQQIVKNYQQELLEGKPKPNNSELVVRNWYNPNLDYKWFVVPSLI AMITTIGVMIVTSLSVAREREQGTLDQLLVSPLTTWQIFIGKAVPALIVATFQATIVLAI GIWAYQIPFAGSLALFYFTMVIYGLSLVGFGLLISSLCSTQQQAFIGVFVFMMPAILLSG YVSPVENMPVWLQNLTWINPIRHFTDITKQIYLKDASLDIVWNSLWPLLVITATTGSAAY AMFRRKVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF488A conjugate, 0.1mg/mL
BNC881133-500 1x 500 µL

CD74 (CLIP/1133), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Luteinizing Hormone beta (LH beta) (LHb/1214), CF647 conjugate, 0.1mg/mL
BNC471214-500 1x 500 µL

Luteinizing Hormone beta (LH beta) (LHb/1214), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF647 conjugate, 0.1mg/mL
BNC471815-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX6 (PAX6/498), CF568 conjugate, 0.1mg/mL
BNC680498-500 1x 500 µL

PAX6 (PAX6/498), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details