Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbA

UniProt

Q7V872

Expression Region

1-368

Origin

Prochlorococcus marinus (strain MIT 9313)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGKTDVTYAWYAGNSGVTNRSGRFIASHIGHTGLICFGAGANTLFELARYDSALPIG DQGFVVLPHLAGLGIGGIENGVITDSYGMLVVAVFHLIFSAVYAGGAMLHSFRYKEDLGE YPQGSRPNKFDFKWDDPDRLTFILGHHLLFLGLGCVQFVEWAKYHGIYDPAMGVVRKVEY NLDLSMVWNHQIDFLTINSLEDVMGGHAFLAFFLSAGAIWHIFSKPFGEYTEFKGKGLLS AEFVLSTSLAGAAFIAFVAAFWASMNTTIYPTDLYGGPLNIELNFAPYFSDTDPLFGGDL HSARSWLSNFHFYLGFFYLQGHFWHGLRAMGFDFKRVEKLFDQLESNEISLNPAKSTTVP STSTDSAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep IgG ELISA Assay
SGG91-K01 1 Kit

Sheep IgG ELISA Assay

Sign In for Pricing
View Details
Pig Forkhead Box Protein P3 (FOXP3) ELISA Kit
abx360542 96 Well

Pig Forkhead Box Protein P3 (FOXP3) ELISA Kit

Sign In for Pricing
View Details
Olr139 CRISPRa sgRNA lentivector (set of three targets)(Rat)
33895126 3x 1.0µg DNA

Olr139 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Anti-POT1 Antibody Picoband® (Carrier-free Conjugate)
PB9780-carrier-free 100 µg/Vial

Anti-POT1 Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
Palmarosa Oil Extrapure
1914A 00500 500 mL

Palmarosa Oil Extrapure

Sign In for Pricing
View Details
RGD1565469 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV641563 1.0 µg DNA

RGD1565469 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details