Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbA

UniProt

Q7V872

Expression Region

1-368

Origin

Prochlorococcus marinus (strain MIT 9313)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGKTDVTYAWYAGNSGVTNRSGRFIASHIGHTGLICFGAGANTLFELARYDSALPIG DQGFVVLPHLAGLGIGGIENGVITDSYGMLVVAVFHLIFSAVYAGGAMLHSFRYKEDLGE YPQGSRPNKFDFKWDDPDRLTFILGHHLLFLGLGCVQFVEWAKYHGIYDPAMGVVRKVEY NLDLSMVWNHQIDFLTINSLEDVMGGHAFLAFFLSAGAIWHIFSKPFGEYTEFKGKGLLS AEFVLSTSLAGAAFIAFVAAFWASMNTTIYPTDLYGGPLNIELNFAPYFSDTDPLFGGDL HSARSWLSNFHFYLGFFYLQGHFWHGLRAMGFDFKRVEKLFDQLESNEISLNPAKSTTVP STSTDSAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nanog polyclonal antibody
BS70530-01 50 µL

Nanog polyclonal antibody

Sign In for Pricing
View Details
Nanog polyclonal antibody
BS70530-02 100 µL

Nanog polyclonal antibody

Sign In for Pricing
View Details
ALOX15B Rabbit Polyclonal Antibody (PerCP)
orb2463254 100 µL

ALOX15B Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
TRNAT1 Protein Vector (Human) (pPM-C-HA)
48402021 500 ng

TRNAT1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Guinea pig Anti-Saccharomyces cerevisiae antibody (ASCA) ELISA Kit
EIA05328Gu 1 Kit

Guinea pig Anti-Saccharomyces cerevisiae antibody (ASCA) ELISA Kit

Sign In for Pricing
View Details
Anti-VEGF Receptor 1/FLT1 Antibody Picoband® (Biotine Conjugate)
PA1966-1-Biotin 100 µg/Vial

Anti-VEGF Receptor 1/FLT1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details