Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Zinc transporter 8 (Slc30a8)

This Recombinant Rat Zinc transporter 8 (Slc30a8) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

Zinc transporter 8, ZnT-8, Solute carrier family 30 member 8

UniProt

P0CE46

Expression Region

1-368

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFLERTYLVNDQATKMYAFTSDRERGQKPVNKDQCPGDGPERPEAGAIYHCHNSFKATG NRSSKQVHAKWRLCAASAICFFFMVAEVVGGHVAGSLAVLTDAAHLLIDLTSFLLSLFSL WLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLVYLACERLLYPDYQIQAGIMITV SGCAVAANIVLTLILHQRHLGHNHKDAQANASVRAAFVHALGDVFQSTSVLISALIIYFK PDYKMADPVCTFISSVLALASTVMILKDFSILLMEGVPKGLSYNSVKELLLTVDGVISVH NLHIWSLTVNQVILSVHVATAASQDSQSVRTGIACALSSSFDLHSLTIQIESAADQDPSC LLCEDPQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-100 1x 100 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-500 1x 500 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-100 1x 100 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (UCHT1), CF405S conjugate, 0.1mg/mL
BNC042473-100 1x 100 µL

CD3e (T-Cell Marker) (UCHT1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details