Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 229A (Tmem229a)

This Recombinant Mouse Transmembrane protein 229A (Tmem229a) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Transmembrane protein 229A

UniProt

B9EJI9

Expression Region

1-371

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSDVASEGPSPRDGATRRPGATGGLRSQAAASCPEPLSAAEAPAERGALPAWMRLYFY GMHGITLDVLVSSARRFARSLDLRMLGFSSPYRCLLHSLTHFALEQLYLQRPRCPSAFLF NFLLYPSAHVGLQTLAGQALRLSLGGGPGGAAAPALGALDLALQYVLALYHGQVFLKRFL CLRYPRRRDQHTRDTLPAARDAQILWEAGGQRRGPGGARGTERSPTQGLPDLLRFLFFGM HGFLDEIFFTFFFNVLGQGDRASSGHTSLWSFFMYGSCSFVVEKLYFHLHYSRGWGTWKR VPIYVIFIYAWEFSWGLGLRMCGACSWDYSHYPLNFMGLITLMYLPGWLFLSVYQDLLSN VLWRVQYVPTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-CARBOXYFluorescein, SE (6-FAM, SE)
#90023 1x 10 mg

6-CARBOXYFluorescein, SE (6-FAM, SE)

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF594 conjugate, 0.1mg/mL
BNC940898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD204 Recombinant Mouse monoclonal Antibody
HA610052 100 µg

CD204 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Maf Rabbit Polyclonal Antibody
TA362870 100 µL

Maf Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HTRA1 Human Gene Knockout Kit (CRISPR)
KN422362 1 Kit

HTRA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant GPA33 Antibody
RC-16023-01 50 μL

Recombinant GPA33 Antibody

Sign In for Pricing
View Details