Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig P2Y purinoceptor 2 (P2RY2)

This Recombinant Pig P2Y purinoceptor 2 (P2RY2) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

P2Y purinoceptor 2, P2Y2

UniProt

Q5YA25

Expression Region

1-373

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATGPDLWNGTVNGTSDGDDWGYRCRFHEDFKYVLLPLSYGVVCVLGLSLNAGALYIFLC RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTALCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLRSLRWGHARYARRVAAAVWGLVLACQAPALYFITTTAQGGR ITCHDTSAPELFSHFVAYSLVMLSVLFAAPFAVILVCYALMARRLLRPAYGTAGGLPRAK RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRTLDLSCHTLDAINMAYKITRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTDATPTAQACRRLGLRRSHGTDTKRTEDSASSEDSRR TEITPARGEDIRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-523-3p miRNA Agomir
CMJ0271-01 5 nmol

Hsa-miR-523-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-523-3p miRNA Agomir
CMJ0271-02 10 nmol

Hsa-miR-523-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-523-3p miRNA Agomir
CMJ0271-03 20 nmol

Hsa-miR-523-3p miRNA Agomir

Sign In for Pricing
View Details
JARID2 Rabbit mAb
C05714-100uL 100 µL

JARID2 Rabbit mAb

Sign In for Pricing
View Details
HSP 47 (E-1)
sc-13150 200 µg/mL

HSP 47 (E-1)

Sign In for Pricing
View Details
Mouse Monoclonal Myosin heavy chain 11 Antibody (MYH11/923) [Janelia Fluor 549]
NBP2-47900JF549 0.1 mL

Mouse Monoclonal Myosin heavy chain 11 Antibody (MYH11/923) [Janelia Fluor 549]

Sign In for Pricing
View Details