Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig P2Y purinoceptor 2 (P2RY2)

This Recombinant Pig P2Y purinoceptor 2 (P2RY2) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

P2Y purinoceptor 2, P2Y2

UniProt

Q5YA25

Expression Region

1-373

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATGPDLWNGTVNGTSDGDDWGYRCRFHEDFKYVLLPLSYGVVCVLGLSLNAGALYIFLC RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTALCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLRSLRWGHARYARRVAAAVWGLVLACQAPALYFITTTAQGGR ITCHDTSAPELFSHFVAYSLVMLSVLFAAPFAVILVCYALMARRLLRPAYGTAGGLPRAK RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRTLDLSCHTLDAINMAYKITRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTDATPTAQACRRLGLRRSHGTDTKRTEDSASSEDSRR TEITPARGEDIRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COASY (Bifunctional Coenzyme A Synthase, NBP, POV-2, Phosphopantetheine Adenylyltransferase, Dephospho-CoA Pyrophosphorylase, Pantetheine-phosphate Adenylyltransferase, Dephospho-CoA Kinase, Dephosphocoenzyme A Kinase, FLJ35179) (MaxLight 650)
MBS6374321-01 0.1 mL

COASY (Bifunctional Coenzyme A Synthase, NBP, POV-2, Phosphopantetheine Adenylyltransferase, Dephospho-CoA Pyrophosphorylase, Pantetheine-phosphate Adenylyltransferase, Dephospho-CoA Kinase, Dephosphocoenzyme A Kinase, FLJ35179) (MaxLight 650)

Sign In for Pricing
View Details
COASY (Bifunctional Coenzyme A Synthase, NBP, POV-2, Phosphopantetheine Adenylyltransferase, Dephospho-CoA Pyrophosphorylase, Pantetheine-phosphate Adenylyltransferase, Dephospho-CoA Kinase, Dephosphocoenzyme A Kinase, FLJ35179) (MaxLight 650)
MBS6374321-02 5x 0.1 mL

COASY (Bifunctional Coenzyme A Synthase, NBP, POV-2, Phosphopantetheine Adenylyltransferase, Dephospho-CoA Pyrophosphorylase, Pantetheine-phosphate Adenylyltransferase, Dephospho-CoA Kinase, Dephosphocoenzyme A Kinase, FLJ35179) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Monoclonal CPS1 Antibody (CPS1/8417)
NBP3-23839-20ug 20 µg

Mouse Monoclonal CPS1 Antibody (CPS1/8417)

Sign In for Pricing
View Details
Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF594 conjugate, 0.1mg/mL
BNC941877-500 1x 500 µL

Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Polyclonal LAMTOR1 Antibody [Janelia Fluor 646]
NBP2-82075JF646 0.1 mL

Rabbit Polyclonal LAMTOR1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
MARCKS (Ab-162) Antibody
MBS7130424-01 0.1 mL

MARCKS (Ab-162) Antibody

Sign In for Pricing
View Details