Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Delta (12) fatty acid dehydrogenase

This Recombinant Delta (12) fatty acid dehydrogenase spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Delta (12) fatty acid dehydrogenase, EC= 1.14.99.33, Crepenynate synthase, Delta-12 fatty acid acetylenase

UniProt

O81931

Expression Region

1-375

Origin

Crepis alpina

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGGGRGRTSQKPLMERVSVDPPFTVSDLKQAIPPHCFKRSVIRSSYYIVHDAIIAYIFY FLADKYIPILPAPLAYLAWPLYWFCQASILTGLWVIGHECGHHAFSDYQWVDDTVGFILH SFLMTPYFSWKYSHRNHHANTNSLDNDEVYIPKSKAKVALYYKVLNHPPGRLLIMFITFT LGFPLYLFTNISGKKYERFANHFDPMSPIFKERERFQVLLSDLGLLAVLYGVKLAVAAKG AAWVTCIYGIPVLGVFIFFDIITYLHHTHLSLPHYDSSEWNWLRGALSTIDRDFGFLNSV LHDVTHTHVMHHLFSYIPHYHAKEARDAINTVLGDFYKIDRTPILKAMWREAKECIFIEP EKGRGSKGVYWYNKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL17B (ARL17A) (NM_016632) Human Tagged ORF Clone Lentiviral Particle
RC225073L3V 200 µL

ARL17B (ARL17A) (NM_016632) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HLX1 (HLX) Human shRNA Plasmid Kit (Locus ID 3142)
TR304083 1 Kit

HLX1 (HLX) Human shRNA Plasmid Kit (Locus ID 3142)

Sign In for Pricing
View Details
ZMAT1 Double Nickase Plasmid (h2)
sc-413650-NIC-2 20 µg

ZMAT1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
APC Mouse IgG2b isotype Control
FC1240 100 Tests

APC Mouse IgG2b isotype Control

Sign In for Pricing
View Details
CCR3 (CD193, CC Chemokine Receptor Type 3, CC CKR 3, CC CKR3, B Chemokine Receptor, CMKBR3, Eosinophil CC Chemokine Receptor 3, Eosinophil Eotaxin Receptor, MGC102841) (APC) discontinued
C2099-92M-APC 100 µL

CCR3 (CD193, CC Chemokine Receptor Type 3, CC CKR 3, CC CKR3, B Chemokine Receptor, CMKBR3, Eosinophil CC Chemokine Receptor 3, Eosinophil Eotaxin Receptor, MGC102841) (APC) discontinued

Sign In for Pricing
View Details
AdmiRa-mmu-miR-5709-5p Virus
mm1474 250 µL

AdmiRa-mmu-miR-5709-5p Virus

Sign In for Pricing
View Details