Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc transporter 7 (SLC30A7)

This Recombinant Human Zinc transporter 7 (SLC30A7) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Zinc transporter 7, ZnT-7, Solute carrier family 30 member 7, Znt-like transporter 2

UniProt

Q8NEW0

Expression Region

1-376

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFN GALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQILQGVFLH ILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTPPL LENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFT QAGVRQLYVQIDFAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JIP3 Antibody
8C11903-AAT 50 µg

JIP3 Antibody

Sign In for Pricing
View Details
Recombinant Human ATG4A Protein (His Tag)
PKSH032099-01 10 µg

Recombinant Human ATG4A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ATG4A Protein (His Tag)
PKSH032099-02 50 µg

Recombinant Human ATG4A Protein (His Tag)

Sign In for Pricing
View Details
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF594 conjugate, 0.1mg/mL
BNC942899-500 1x 500 µL

Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acid Orange 3, Technical Grade
TRC-A189883-5G 5 g

Acid Orange 3, Technical Grade

Sign In for Pricing
View Details
ATBF1 Rabbit Polyclonal Antibody
HA500181 100 µL

ATBF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details