Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc transporter 7 (SLC30A7)

This Recombinant Human Zinc transporter 7 (SLC30A7) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Zinc transporter 7, ZnT-7, Solute carrier family 30 member 7, Znt-like transporter 2

UniProt

Q8NEW0

Expression Region

1-376

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFN GALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQILQGVFLH ILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTPPL LENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFT QAGVRQLYVQIDFAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Histone H3 Antibody
RC-6808-01 50 μL

Recombinant Histone H3 Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 Antibody
RC-6808-02 100 µL

Recombinant Histone H3 Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 Antibody
RC-6808-03 1 mL

Recombinant Histone H3 Antibody

Sign In for Pricing
View Details
Anti Human JSRP1 Polyclonal
Y054952 100 µL

Anti Human JSRP1 Polyclonal

Sign In for Pricing
View Details
Mouse IL-1α Antibody Pair Set
E-KAB-0565 50 µL & 100 µg

Mouse IL-1α Antibody Pair Set

Sign In for Pricing
View Details
KGF (FGF7) (NM_002009) Human Over-expression Lysate
LY400734 100 µg

KGF (FGF7) (NM_002009) Human Over-expression Lysate

Sign In for Pricing
View Details