Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yibH (yibH)

This Recombinant Inner membrane protein yibH (yibH) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Inner membrane protein yibH

UniProt

P0AFV1

Expression Region

1-378

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLLIVLTYVALAWAVFKIFRIPVNQWTLATAALGGVFLVSGLILLMNYNHPYTFTAQKA VIAIPITPQVTGIVTEVTDKNNQLIQKGEVLFKLDPVRYQARVDRLQADLMTATHNIKTL RAQLTEAQANTTQVSAERDRLFKNYQRYLKGSQAAVNPFSERDIDDARQNFLAQDALVKG SVAEQAQIQSQLDSMVNGEQSQIVSLRAQLTEAKYNLEQTVIRAPSNGYVTQVLIRPGTY AAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDDAEVVFNALPGQVFHGKLTSILPV VPGGSYQAQGVLQSLTVVPGTDGVLGTIELDPNDDIDALPDGIYAQVAVYSDHFSHVSVM RKVLLRMTSWMHYLYLDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CoREST (RCOR1) Rabbit Polyclonal Antibody
TA372266 100 µL

CoREST (RCOR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), CF740 conjugate, 0.1mg/mL
BNC741408-500 1x 500 µL

Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZCCHC10 (10-14) Rabbit Polyclonal Antibody
AP26053PU-S 50 µL

ZCCHC10 (10-14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
rac-trans-1,2-Bis(2-mercaptoacetamido)cyclohexane Disulfide
TRC-B481460-50MG 50 mg

rac-trans-1,2-Bis(2-mercaptoacetamido)cyclohexane Disulfide

Sign In for Pricing
View Details
BMP 4 Human, Active
OM296912-01 10 µg

BMP 4 Human, Active

Sign In for Pricing
View Details
BMP 4 Human, Active
OM296912-02 2 µg

BMP 4 Human, Active

Sign In for Pricing
View Details