Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Zinc transporter 7 (Slc30a7)

This Recombinant Rat Zinc transporter 7 (Slc30a7) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Zinc transporter 7, ZnT-7, Solute carrier family 30 member 7

UniProt

Q5BJM8

Expression Region

1-378

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFN GALDHSHGHEDHCHSHGAKHGGAHSHDHDHAHGHGHLHSHDGPSFKETAGPSRQILQGVF LHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESIGILMQRTP PSLENVLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNI FTQAGVRQLYVQIDFAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAP3K9 activation kit by CRISPRa
GA102919 1 Kit

Human MAP3K9 activation kit by CRISPRa

Sign In for Pricing
View Details
G-CSF Receptor Antibody
KC-1675-01 50 μL

G-CSF Receptor Antibody

Sign In for Pricing
View Details
G-CSF Receptor Antibody
KC-1675-02 100 µL

G-CSF Receptor Antibody

Sign In for Pricing
View Details
G-CSF Receptor Antibody
KC-1675-03 1 mL

G-CSF Receptor Antibody

Sign In for Pricing
View Details
α, ω-Bis-Maleimido PEG
116000-45.5G 5 g

α, ω-Bis-Maleimido PEG

Sign In for Pricing
View Details
Synaptopodin 2 (SYNPO2) (NM_001128934) Human Over-expression Lysate
LC427035 20 µg

Synaptopodin 2 (SYNPO2) (NM_001128934) Human Over-expression Lysate

Sign In for Pricing
View Details