Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Zinc transporter 7 (Slc30a7)

This Recombinant Rat Zinc transporter 7 (Slc30a7) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Zinc transporter 7, ZnT-7, Solute carrier family 30 member 7

UniProt

Q5BJM8

Expression Region

1-378

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFN GALDHSHGHEDHCHSHGAKHGGAHSHDHDHAHGHGHLHSHDGPSFKETAGPSRQILQGVF LHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESIGILMQRTP PSLENVLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNI FTQAGVRQLYVQIDFAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC23B Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF810138 100 µg

SEC23B Mouse Monoclonal Antibody [Clone ID: OTI1B2]

Sign In for Pricing
View Details
alpha Tubulin Rabbit Polyclonal Antibody
ER130905 100 µL

alpha Tubulin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLCC1 (NM_001048210) Human Recombinant Protein
TP313260M 100 µg

CLCC1 (NM_001048210) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse Ccl7 Protein (GST Tag)
PDEM100323-01 20 µg

Recombinant Mouse Ccl7 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ccl7 Protein (GST Tag)
PDEM100323-02 100 µg

Recombinant Mouse Ccl7 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ccl7 Protein (GST Tag)
PDEM100323-03 500 µg

Recombinant Mouse Ccl7 Protein (GST Tag)

Sign In for Pricing
View Details