Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zinc transporter 7 (Slc30a7)

This Recombinant Mouse Zinc transporter 7 (Slc30a7) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Zinc transporter 7, ZnT-7, Solute carrier family 30 member 7, Znt-like transporter 2

UniProt

Q9JKN1

Expression Region

1-378

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFN GALDHSHGHEDHCHSHEAKHGAAHSHDHDHAHGHGHLHSHDGPSFKATAGPSRQILQGVF LHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTP PSLENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNI FTQAGVRQLYVQIDFAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A15 siRNA (Mouse)
orb1835703-01 15 nmol

SLC22A15 siRNA (Mouse)

Sign In for Pricing
View Details
SLC22A15 siRNA (Mouse)
orb1835703-02 30 nmol

SLC22A15 siRNA (Mouse)

Sign In for Pricing
View Details
Anti-Mouse TCR Alpha/Beta FITC
HM900913 50 Tests

Anti-Mouse TCR Alpha/Beta FITC

Sign In for Pricing
View Details
DATE INSPECTION LBLS B-500 29 - DIA 35 Inspection & Calibration Labels
833987 125 Pack (5 Label (s) x 25 Card)

DATE INSPECTION LBLS B-500 29 - DIA 35 Inspection & Calibration Labels

Sign In for Pricing
View Details
Recombinant Rhesus Macaque SCFD1 Protein, His (Fc)-Avi-tagged
SCFD1-3906R 50 µg

Recombinant Rhesus Macaque SCFD1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
KIAA1549 sgRNA CRISPR Lentivector (Human) (Target 1)
K1142102 1.0 µg DNA

KIAA1549 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details