Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zinc transporter 7 (Slc30a7)

This Recombinant Mouse Zinc transporter 7 (Slc30a7) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Zinc transporter 7, ZnT-7, Solute carrier family 30 member 7, Znt-like transporter 2

UniProt

Q9JKN1

Expression Region

1-378

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFN GALDHSHGHEDHCHSHEAKHGAAHSHDHDHAHGHGHLHSHDGPSFKATAGPSRQILQGVF LHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTP PSLENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNI FTQAGVRQLYVQIDFAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cluster of differentiation 7 ELISA Kit
ELA-E1784h 96 Tests

Human Cluster of differentiation 7 ELISA Kit

Sign In for Pricing
View Details
4-Hydroxycyclohexylcarboxylic Acid-d5
TRC-H926022-100MG 100 mg

4-Hydroxycyclohexylcarboxylic Acid-d5

Sign In for Pricing
View Details
GPR171 Recombinant Protein (Rat)
RP203363 100 µg

GPR171 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 9 (FGF9) ELISA Kit
MBS2022091-01 24 Strip Well

Human Fibroblast Growth Factor 9 (FGF9) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 9 (FGF9) ELISA Kit
MBS2022091-02 48 Well

Human Fibroblast Growth Factor 9 (FGF9) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 9 (FGF9) ELISA Kit
MBS2022091-03 96 Well

Human Fibroblast Growth Factor 9 (FGF9) ELISA Kit

Sign In for Pricing
View Details