Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zinc transporter 7 (Slc30a7)

This Recombinant Mouse Zinc transporter 7 (Slc30a7) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Zinc transporter 7, ZnT-7, Solute carrier family 30 member 7, Znt-like transporter 2

UniProt

Q9JKN1

Expression Region

1-378

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFN GALDHSHGHEDHCHSHEAKHGAAHSHDHDHAHGHGHLHSHDGPSFKATAGPSRQILQGVF LHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTP PSLENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNI FTQAGVRQLYVQIDFAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FASTKD5 Antibody - N-terminal region : HRP (ARP73532_P050-HRP)
ARP73532_P050-HRP 100 µL

FASTKD5 Antibody - N-terminal region : HRP (ARP73532_P050-HRP)

Sign In for Pricing
View Details
WWTR1 Protein Vector (Human) (pPM-C-HA)
50490021 500 ng

WWTR1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Alpha-1B-glycoprotein (A1BG) ELISA Kit
MBS280448-01 48 Tests

Rabbit Alpha-1B-glycoprotein (A1BG) ELISA Kit

Sign In for Pricing
View Details
Rabbit Alpha-1B-glycoprotein (A1BG) ELISA Kit
MBS280448-02 96 Tests

Rabbit Alpha-1B-glycoprotein (A1BG) ELISA Kit

Sign In for Pricing
View Details
Rabbit Alpha-1B-glycoprotein (A1BG) ELISA Kit
MBS280448-03 5x 96 Tests

Rabbit Alpha-1B-glycoprotein (A1BG) ELISA Kit

Sign In for Pricing
View Details
Rabbit Alpha-1B-glycoprotein (A1BG) ELISA Kit
MBS280448-04 10x 96 Tests

Rabbit Alpha-1B-glycoprotein (A1BG) ELISA Kit

Sign In for Pricing
View Details