Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Flagellar biosynthetic protein fliP (fliP)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum Flagellar biosynthetic protein fliP (fliP) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein fliP

UniProt

Q8KA37

Expression Region

1-379

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENNVYSQIAPSIFKRIFDDTNIFHVMSSLFGMLLLVLILIWILKKISLLKINKNNYFIK TIDRMSLGPNESIVIIKIEEIKLVLGITKNHITHLYTLSSDVKDDVVDKKKEVILPTKNF NDSLKNFAKIFWKKTMFYRIIPLFFLFLFCPLVYADIPGPTSHILRDGSQTWSLPVQTLI FLTSLTFLPAFLLMMTSFTRIIIVFGLLRNALGTPYAPPNQILLGLALFLTFFIMSPTFD QVYKEAYLPFSQEKINMDEAIIKGAVPLKKFMLNQTRNSDLELFSKLAHISSYKNKDEIP MRILLPSFITSELKTAFQIGFTIFIPFLIIDLVVASVLMALGMMMVPPSTISLPFKLMLF VLVDGWQLLVTSLSQSFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-100 1x 100 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-500 1x 500 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-100 1x 100 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details