Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Mitoferrin (mfrn)

This Recombinant Drosophila melanogaster Mitoferrin (mfrn) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Mitoferrin, dmfrn

UniProt

Q9VAY3

Expression Region

1-379

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIDDYESLPTTSVGVNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRT MITREGLLRPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNYVISGAVATLI HDAISSPTDVIKQRMQMYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHF TTYEFFQNKMNLERKYNPPVHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEA SRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEFFKFYLCGLDADQYKSSITGSSEP RKADYVLPRTTDEEQIDQEREAAKEKDTTATLHSAPTSVNASGAIKTVCELSTRPAGPTI NLHTRHTDVKSPYERGFST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (2H11), 0.2mg/mL
BNUB0023-100 1x 100 µL

Thyroglobulin (2H11), 0.2mg/mL

Sign In for Pricing
View Details
LNP (LNPK) (NM_030650) Human Recombinant Protein
TP313378 20 µg

LNP (LNPK) (NM_030650) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF594 conjugate, 0.1mg/mL
BNC941992-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Muscle tissue
CS800837 5x 5 µm

Tissue FFPE Sections, Muscle tissue

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS503517 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
NUDT15 (NM_018283) Human Over-expression Lysate
LC402670 20 µg

NUDT15 (NM_018283) Human Over-expression Lysate

Sign In for Pricing
View Details