Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Ceramide synthase 2 (CERS2)

This Recombinant Bovine Ceramide synthase 2 (CERS2) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Ceramide synthase 2, CerS2, LAG1 longevity assurance homolog 2

UniProt

Q3ZBF8

Expression Region

1-380

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQTLHDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIIRYFFELYV ATPLAALLNVKEKTRLRAPPNPTLEHFYMTSGKQPKQADVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGTAVIVDKPWFYDLRKVWEGYPIQSIIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYVRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNFMMGVLQLLHIFWAYLILRMAHKFITGKVVEDERSDREETESSEGEEAAAGGGA KNRPLANGHPILNNNHRKND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 7 (CLDN7) Human siRNA Oligo Duplex (Locus ID 1366)
SR319789 1 Kit

Claudin 7 (CLDN7) Human siRNA Oligo Duplex (Locus ID 1366)

Sign In for Pricing
View Details
Mucin 16 (MUC16, MUC-16, CA125, CA-125, Cancer Antigen 125, FLJ14303, Mucin 16 Cell Surface Associated, Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125) (MaxLight 490)
MBS6254121-01 0.1 mL

Mucin 16 (MUC16, MUC-16, CA125, CA-125, Cancer Antigen 125, FLJ14303, Mucin 16 Cell Surface Associated, Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125) (MaxLight 490)

Sign In for Pricing
View Details
Mucin 16 (MUC16, MUC-16, CA125, CA-125, Cancer Antigen 125, FLJ14303, Mucin 16 Cell Surface Associated, Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125) (MaxLight 490)
MBS6254121-02 5x 0.1 mL

Mucin 16 (MUC16, MUC-16, CA125, CA-125, Cancer Antigen 125, FLJ14303, Mucin 16 Cell Surface Associated, Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125) (MaxLight 490)

Sign In for Pricing
View Details
KATL1, NT (KATNAL1, Katanin p60 ATPase-containing subunit A-like 1, p60 katanin-like 1) (MaxLight 490) discontinued
037274-ML490 100 µL

KATL1, NT (KATNAL1, Katanin p60 ATPase-containing subunit A-like 1, p60 katanin-like 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
HMGCR Rabbit Monoclonal Antibody [Clone ID: R04-2J3]
TA384442 100 µL

HMGCR Rabbit Monoclonal Antibody [Clone ID: R04-2J3]

Sign In for Pricing
View Details
Rabbit Monoclonal S1P3/EDG-3 Antibody (SR1721)
NBP3-22220-50ul 50 µL

Rabbit Monoclonal S1P3/EDG-3 Antibody (SR1721)

Sign In for Pricing
View Details