Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Ceramide synthase 2 (CERS2)

This Recombinant Bovine Ceramide synthase 2 (CERS2) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Ceramide synthase 2, CerS2, LAG1 longevity assurance homolog 2

UniProt

Q3ZBF8

Expression Region

1-380

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQTLHDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIIRYFFELYV ATPLAALLNVKEKTRLRAPPNPTLEHFYMTSGKQPKQADVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGTAVIVDKPWFYDLRKVWEGYPIQSIIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYVRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNFMMGVLQLLHIFWAYLILRMAHKFITGKVVEDERSDREETESSEGEEAAAGGGA KNRPLANGHPILNNNHRKND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Syndecan 2 ELISA kit
GTR10387066 96 Well

Rat Syndecan 2 ELISA kit

Sign In for Pricing
View Details
GPA33 Polyclonal Antibody
A51213-020 20 µL

GPA33 Polyclonal Antibody

Sign In for Pricing
View Details
SYNJ1 Rabbit Polyclonal Antibody
orb577964 100 µL

SYNJ1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Sorangium cellulosum Enolase-phosphatase E1 (mtnC)
MBS1053688-01 0.02 mg (E-Coli)

Recombinant Sorangium cellulosum Enolase-phosphatase E1 (mtnC)

Sign In for Pricing
View Details
Recombinant Sorangium cellulosum Enolase-phosphatase E1 (mtnC)
MBS1053688-02 0.1 mg (E-Coli)

Recombinant Sorangium cellulosum Enolase-phosphatase E1 (mtnC)

Sign In for Pricing
View Details
Recombinant Sorangium cellulosum Enolase-phosphatase E1 (mtnC)
MBS1053688-03 0.02 mg (Yeast)

Recombinant Sorangium cellulosum Enolase-phosphatase E1 (mtnC)

Sign In for Pricing
View Details