Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Ceramide synthase 2 (CERS2)

This Recombinant Bovine Ceramide synthase 2 (CERS2) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Ceramide synthase 2, CerS2, LAG1 longevity assurance homolog 2

UniProt

Q3ZBF8

Expression Region

1-380

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQTLHDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIIRYFFELYV ATPLAALLNVKEKTRLRAPPNPTLEHFYMTSGKQPKQADVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGTAVIVDKPWFYDLRKVWEGYPIQSIIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYVRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNFMMGVLQLLHIFWAYLILRMAHKFITGKVVEDERSDREETESSEGEEAAAGGGA KNRPLANGHPILNNNHRKND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Claudin-2, CLDN2 ELISA KIT
ELI-50979b 96 Tests

Bovine Claudin-2, CLDN2 ELISA KIT

Sign In for Pricing
View Details
Mouse Ergic3 ELISA Kit
EF014821 96 Tests

Mouse Ergic3 ELISA Kit

Sign In for Pricing
View Details
Monoclonal Antibody to CADM1 (Clone: ABM2A73)
MBS668976-01 0.025 mg

Monoclonal Antibody to CADM1 (Clone: ABM2A73)

Sign In for Pricing
View Details
Monoclonal Antibody to CADM1 (Clone: ABM2A73)
MBS668976-02 0.1 mg

Monoclonal Antibody to CADM1 (Clone: ABM2A73)

Sign In for Pricing
View Details
Monoclonal Antibody to CADM1 (Clone: ABM2A73)
MBS668976-03 5x 0.1 mg

Monoclonal Antibody to CADM1 (Clone: ABM2A73)

Sign In for Pricing
View Details
Rabbit Polyclonal Podocin/NPHS2 Antibody [Janelia Fluor 635]
NBP3-18129JF635 0.1 mL

Rabbit Polyclonal Podocin/NPHS2 Antibody [Janelia Fluor 635]

Sign In for Pricing
View Details