Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 2 (CERS2)

This Recombinant Human Ceramide synthase 2 (CERS2) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Ceramide synthase 2, CerS2, LAG1 longevity assurance homolog 2, SP260, Tumor metastasis-suppressor gene 1 protein

UniProt

Q96G23

Expression Region

1-380

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA KSRPLANGHPILNNNHRKND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNE4 (Potassium Voltage-gated Channel Subfamily E Member 4, MinK-related Peptide 3, Minimum Potassium Ion Channel-related Peptide 3, Potassium Channel Subunit beta MiRP3, MGC20353) (FITC)
128738-FITC 100 µL

KCNE4 (Potassium Voltage-gated Channel Subfamily E Member 4, MinK-related Peptide 3, Minimum Potassium Ion Channel-related Peptide 3, Potassium Channel Subunit beta MiRP3, MGC20353) (FITC)

Sign In for Pricing
View Details
Recombinant MSH6 Antibody
V9344-100UG 100 µg

Recombinant MSH6 Antibody

Sign In for Pricing
View Details
Human Asparagine Synthetase (ASNS) ELISA Kit
BSKH63143-01 48 Tests

Human Asparagine Synthetase (ASNS) ELISA Kit

Sign In for Pricing
View Details
Human Asparagine Synthetase (ASNS) ELISA Kit
BSKH63143-02 96 Tests

Human Asparagine Synthetase (ASNS) ELISA Kit

Sign In for Pricing
View Details
Rat Zmym5 Pre-designed siRNA Set B
SI216507B 1 Each

Rat Zmym5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IFT122 Protein Vector (Mouse) (pPB-C-His)
PV190822 500 ng

IFT122 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details