Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 2 (CERS2)

This Recombinant Human Ceramide synthase 2 (CERS2) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Ceramide synthase 2, CerS2, LAG1 longevity assurance homolog 2, SP260, Tumor metastasis-suppressor gene 1 protein

UniProt

Q96G23

Expression Region

1-380

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA KSRPLANGHPILNNNHRKND

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ADRM1 shRNA Plasmid
abx974772-01 150 µg

Mouse ADRM1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ADRM1 shRNA Plasmid
abx974772-02 300 µg

Mouse ADRM1 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Neurospora crassa Putative lipase atg-15 (atg-15), partial
MBS1343669 Inquire

Recombinant Neurospora crassa Putative lipase atg-15 (atg-15), partial

Sign In for Pricing
View Details
Rat ATP synthase subunit s, mitochondrial (DMAC2L) ELISA Kit
abx503140 96 Tests

Rat ATP synthase subunit s, mitochondrial (DMAC2L) ELISA Kit

Sign In for Pricing
View Details
OR7A2 Antibody
C45322-01 50 µL

OR7A2 Antibody

Sign In for Pricing
View Details
OR7A2 Antibody
C45322-02 100 µL

OR7A2 Antibody

Sign In for Pricing
View Details