Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 2 (CERS2)

This Recombinant Human Ceramide synthase 2 (CERS2) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Ceramide synthase 2, CerS2, LAG1 longevity assurance homolog 2, SP260, Tumor metastasis-suppressor gene 1 protein

UniProt

Q96G23

Expression Region

1-380

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA KSRPLANGHPILNNNHRKND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NARS1 activation kit by CRISPRa
GA103109 1 Kit

Human NARS1 activation kit by CRISPRa

Sign In for Pricing
View Details
5-[ (3-Methyl-4-nitrophenoxy) methyl]furan-2-carbaldehyde
NSA22091-01 250 mg

5-[ (3-Methyl-4-nitrophenoxy) methyl]furan-2-carbaldehyde

Sign In for Pricing
View Details
5-[ (3-Methyl-4-nitrophenoxy) methyl]furan-2-carbaldehyde
NSA22091-02 2.5 g

5-[ (3-Methyl-4-nitrophenoxy) methyl]furan-2-carbaldehyde

Sign In for Pricing
View Details
Nova2 Rabbit Polyclonal Antibody (PE-Cy7)
orb871662 100 µL

Nova2 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Doxycycline Hyclate Impurity 19
RM-D152519-01 10 mg

Doxycycline Hyclate Impurity 19

Sign In for Pricing
View Details
Doxycycline Hyclate Impurity 19
RM-D152519-02 100 mg

Doxycycline Hyclate Impurity 19

Sign In for Pricing
View Details