Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaeromyxobacter dehalogenans ATP synthase subunit a (atpB)

This Recombinant Anaeromyxobacter dehalogenans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2IHP4

Expression Region

1-381

Origin

Anaeromyxobacter dehalogenans (strain 2CP-C)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAATLVTLALSLSLAQHDAAPAPVAAPVEQHGQAPEAAPDAHGSPAGEPGAAVEAHAAA AEHGEAAGHEGGHDESLGAVMLHHVTDGYVIEHPGLCHGGLAWNCEWDLRETFGDSLKFG KLDMTPTKHVVMMWLASALLLVVVLGAVRKKSLVPRGLYNFIELLVAFVRNEIAVKNMGE KDADRFTPYLVTAFFFILFLNLFGLLPFSATATANLSVTVAMALFTFVITQYAAIRAMGM GGYLAHLTGGVPKSLAPLWLIMIPVEFLGLFTKPFALTVRLFANMLAGHFVILALLGLIF ALGTPWVAFGSVPMALSIFLLELFVAFVQAYIFTMLSSLFIGAGLVHHGDDHGHAEEHGH AGPAAGSEHGSHVAGASPGHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Biotinidase/BTD Protein (His Tag)
PKSH030529 50 µg

Recombinant Human Biotinidase/BTD Protein (His Tag)

Sign In for Pricing
View Details
Gellan Gum
CN-G045-5KG 5 Kg

Gellan Gum

Sign In for Pricing
View Details
-86°C ULT Freezer Chest BFRZ-86-202
BFRZ-86-202 1 Unit

-86°C ULT Freezer Chest BFRZ-86-202

Sign In for Pricing
View Details
RBM46 (NM_144979) Human Recombinant Protein
TP305574 20 µg

RBM46 (NM_144979) Human Recombinant Protein

Sign In for Pricing
View Details
EGFR (GFR1195 + 31G7), CF568 conjugate, 0.1mg/mL
BNC681200-500 1x 500 µL

EGFR (GFR1195 + 31G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2-Epoxy GA3
TRC-E589425-2.5MG 2.5 mg

1,2-Epoxy GA3

Sign In for Pricing
View Details