Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaeromyxobacter dehalogenans ATP synthase subunit a (atpB)

This Recombinant Anaeromyxobacter dehalogenans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2IHP4

Expression Region

1-381

Origin

Anaeromyxobacter dehalogenans (strain 2CP-C)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAATLVTLALSLSLAQHDAAPAPVAAPVEQHGQAPEAAPDAHGSPAGEPGAAVEAHAAA AEHGEAAGHEGGHDESLGAVMLHHVTDGYVIEHPGLCHGGLAWNCEWDLRETFGDSLKFG KLDMTPTKHVVMMWLASALLLVVVLGAVRKKSLVPRGLYNFIELLVAFVRNEIAVKNMGE KDADRFTPYLVTAFFFILFLNLFGLLPFSATATANLSVTVAMALFTFVITQYAAIRAMGM GGYLAHLTGGVPKSLAPLWLIMIPVEFLGLFTKPFALTVRLFANMLAGHFVILALLGLIF ALGTPWVAFGSVPMALSIFLLELFVAFVQAYIFTMLSSLFIGAGLVHHGDDHGHAEEHGH AGPAAGSEHGSHVAGASPGHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MelanA Antibody
OC-015-01 50 μL

MelanA Antibody

Sign In for Pricing
View Details
MelanA Antibody
OC-015-02 100 µL

MelanA Antibody

Sign In for Pricing
View Details
MelanA Antibody
OC-015-03 1 mL

MelanA Antibody

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), 1mg/mL
BNUM1807-50 1x 50 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), 1mg/mL

Sign In for Pricing
View Details
SNED1 (NM_001080437) Human Over-expression Lysate
LY421654 100 µg

SNED1 (NM_001080437) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2a,  20nm
GM-301-20 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2a, 20nm

Sign In for Pricing
View Details